Documents that we receive from a manufacturer of a Samsung Q46 can be divided into several groups. They are, among others:
- Samsung technical drawings
- Q46 manuals
- Samsung product data sheets
- information booklets
- or energy labels Samsung Q46
All of them are important, but the most important information from the point of view of use of the device are in the user manual Samsung Q46.
- UserManuals.org
- Samsung
- Samsung Laptop
- Samsung Q46
Manual Samsung Q46
Go to site of 194
- 1
- 2
- 3
- 4
- 5
- 6
- 7
- 8
- 9
- 10
- 11
- 12
- 13
- 14
- 15
- 16
- 17
- 18
- 19
- 20
- 21
- 22
- 23
- 24
- 25
- 26
- 27
- 28
- 29
- 30
- 31
- 32
- 33
- 34
- 35
- 36
- 37
- 38
- 39
- 40
- 41
- 42
- 43
- 44
- 45
- 46
- 47
- 48
- 49
- 50
- 51
- 52
- 53
- 54
- 55
- 56
- 57
- 58
- 59
- 60
- 61
- 62
- 63
- 64
- 65
- 66
- 67
- 68
- 69
- 70
- 71
- 72
- 73
- 74
- 75
- 76
- 77
- 78
- 79
- 80
- 81
- 82
- 83
- 84
- 85
- 86
- 87
- 88
- 89
- 90
- 91
- 92
- 93
- 94
- 95
- 96
- 97
- 98
- 99
- 100
- 101
- 102
- 103
- 104
- 105
- 106
- 107
- 108
- 109
- 110
- 111
- 112
- 113
- 114
- 115
- 116
- 117
- 118
- 119
- 120
- 121
- 122
- 123
- 124
- 125
- 126
- 127
- 128
- 129
- 130
- 131
- 132
- 133
- 134
- 135
- 136
- 137
- 138
- 139
- 140
- 141
- 142
- 143
- 144
- 145
- 146
- 147
- 148
- 149
- 150
- 151
- 152
- 153
- 154
- 155
- 156
- 157
- 158
- 159
- 160
- 161
- 162
- 163
- 164
- 165
- 166
- 167
- 168
- 169
- 170
- 171
- 172
- 173
- 174
- 175
- 176
- 177
- 178
- 179
- 180
- 181
- 182
- 183
- 184
- 185
- 186
- 187
- 188
- 189
- 190
- 191
- 192
- 193
- 194
Summary
-
Samsung Q46 - page 1
User Guide Q45/Q46 ...
-
Samsung Q46 - page 2
Chapter 1. Getting Started Product Features 2 Before Y ou Start 3 Contents 5 Safety Precautions 6 Proper Posture During Computer Use 15 Important Safety Information 18 Replacement Parts and Accessories 20 Regulatory Compliance Statements 22 WEEE SYMBOL INFORMA TION 32 Overview 33 Front View 33 Status Indicators 34 Right View 35 Left View 36 Back Vi ...
-
Samsung Q46 - page 3
2 High Performance Notebook Computer ■ IntelCore™2DuoProcessor * .DDRIIMemory ■ WirelessLAN * ,Bluetooth * Easy-to-Use A V ■ Play A VStationand A VStationNow * areprovidedtoeasilyplayvarious multimediales. ■ CameraModuleInstalled(1.3MPixelsorHighe ...
-
Samsung Q46 - page 4
3 Before Y ou Start BeforereadingtheUserGuide,rstcheckthefollowinginformation. User Guide Information Thisproductissuppliedwithan Installation Guide , and a User Guide . Y oucanevenmoreeasilyandconvenientlyusethe computerbyusinganyoftheguidesdepending ...
-
Samsung Q46 - page 5
4 Safety Precaution Notations Icon Notation Description W arning Failingtofollowinstructionsmarkedwith thissymbol,maycausepersonalinjury andorfatality . Caution Failingtofollowinstructionsmarkedwith thissymbol,maycauseslightinjuryto yourselfordamageyourprop ...
-
Samsung Q46 - page 6
5 Contents Chapter 1. Getting Started Product Features 2 Before Y ou Start 3 Contents 5 Safety Precautions 6 Proper Posture During Computer Use 1 5 Important Safety Information 1 8 Replacement Parts and Accessories 2 0 Regulatory Compliance Statements 2 2 WEEE SYMBOL INFORMA TION 3 2 Overview 3 3 Front View 3 3 Status Indicators 34 Right View 35 Le ...
-
Samsung Q46 - page 7
6 Installation Related Power Related Do not install the product in places exposed to humidity such as a bathrooms. Thereisadangerofelectric shock. Use the product within the operatingconditionsspeciedin theManufacturersUserGuide. Keep the plastic bags out of the reach of children. There is a danger of suffo ...
-
Samsung Q46 - page 8
7 If the power cord or power outlet makes a noise, disconnect the power cord from the wall outlet and contact a service center . Thereisadangerofelectricshock orrehazard. Do not use a damaged or loose mains plug or power cord or power outlet. Thereisadangerofelectricshock orrehazard. Plug ...
-
Samsung Q46 - page 9
8 Keep the battery out of the reach of infants and pets, as they could put the battery into their mouths. Thereisadangerofelectric shock or choking. Battery Usage Related If water or another substance enters the power input jack, AC adapter or the computer , disconnect the power cord and contact the service center . Damageto ...
-
Samsung Q46 - page 10
9 Do not place any container lled with water or chemicals over or near the computer . Ifwaterorchemicalsenterthe computer ,thismaycausereor electricshock. If the computer is broken or dropped, disconnect the power cord and contact a service center for a safety check. Usingabrokencomputermay? ...
-
Samsung Q46 - page 11
10 Shut down the computer and disconnect all cables before disassembling the computer . If there is a modem, disconnect the phone line. If you are using a notebook computer , make sure to remove the battery . Failingtodoso,maycause electricshock. Custody and Movement Related Follow the instructions for the relevant location (e. ...
-
Samsung Q46 - page 12
1 1 Caution Failingtofollowinstructionsmarkedwiththissymbolmaycauseslightinjuryordamagetotheproduct. Installation Related Battery Usage Related Do not block the ports (holes), vents, etc. of the product and do not insert objects. Damagetoacomponentwithin thecomputermaycausee ...
-
Samsung Q46 - page 13
12 Usage Related Do not place a candle, lighted cigar , etc. over or on the product. Thereisadangerofre. Make sure to have the product tested by a safety service engineer after repairing the product. AuthorisedSamsungRepair Centerswillcarryoutsafetychecks after a repair . Using a repaired productwitho ...
-
Samsung Q46 - page 14
13 Upgrade Related T ake care when touching the product or parts. Thedevicemaybedamagedor youmaybeinjured. T ake care not to throw or drop a computer part or device. Thismaycauseinjuryordamage to the product. Make sure to close the computer cover before connecting the power after a reassembly . Therei ...
-
Samsung Q46 - page 15
14 Custody and Movement Related When moving the product, turn the power off and separate all connected cables rst. Theproductmightbedamagedor usersmaytripoverthecables. For long periods of not using the notebook computer , discharge the battery and preserve as it is detached. Thebatterywillbepreserved ...
-
Samsung Q46 - page 16
15 Proper Posture Adjust the heights of desks and chairs appropriate to your height. Theheightsaretobeadjustedsothatyourarmformsa rightanglewhenyouplaceyourhandoverthekeyboard whilesittingdownonachair . Adjusttheheightofchairsothatyourheelis? ...
-
Samsung Q46 - page 17
16 Eye Position Keep the monitor or LCD away from your eyes by at least 50cm. ■ AdjusttheheightofthemonitorandtheLCDscreenso thatitstopheightisequaltoorlowerthanyoureyes. ■ AvoidsettingthemonitorandLCDexcessivelybright. ■ Keepthemonitorand ...
-
Samsung Q46 - page 18
17 V olume Control (Headphones and Speakers) Check your volume rst to listen to music. ■ Checkifthevolumeistooloudbeforeusing headphones. ■ Itisnotrecommendedusingheadphonesforlong periods of time. Use Time (Break T ime) ■ T akeabreakfor10minutesormoreafter ...
-
Samsung Q46 - page 19
18 Y oursystemisdesignedandtestedtomeetthelatest standardsforsafetyofinformationtechnologyequipment. However ,toensuresafeuseofthisproduct,itisimportant thatthesafetyinstructionsmarkedontheproductandin thedocumentationarefollow ...
-
Samsung Q46 - page 20
19 Care During Use ■ Donotwalkonthepowercordorallowanythingtorest on it. ■ Donotspillanythingonthesystem.Thebestwayto avoidspillsistonoteatordrinknearyoursystem. ■ SomeproductshaveareplaceableCMOSbatteryon the ...
-
Samsung Q46 - page 21
20 Caution Donotputrechargeablebatteriesorproducts poweredbynon-removablerechargeablebatteries inthegarbage. ContacttheSamsungHelplineforinformationonhowto disposeofbatteriesthatyoucannotuseorrechargeany longer . Followal llocalregulat ions? ...
-
Samsung Q46 - page 22
21 Thesocket-outletshallbeinstalledneartheequipment andshallbeeasilyaccessible. Do not unplug the power cord out by pulling the cable only . Connect and Disconnect the AC adapter Thepowercordset(wallplug,cableand ACadapterplug) youreceivedwithyourcomputermeetsthe ...
-
Samsung Q46 - page 23
22 Regulatory Compliance Statements Wirel ess Guidance Lowpower ,RadioLANtypedevices(radiofrequency(RF)wirelesscommunicationdevices),operatinginthe2.4GHz Band,maybepresent(embedded)in yournotebooksystem.Thef ollowingsectionisageneraloverviewofconsi ...
-
Samsung Q46 - page 24
23 Caution ■ Radiofrequencywirelesscommunicationcaninterferewithequipmentoncommercialaircraft.Currentaviationregulations requirewirelessdevicestobeturnedoffwhiletravelinginanairplane. 802.1 1B(alsoknownaswirelessEthernetorWi)andBluetooth ...
-
Samsung Q46 - page 25
24 USA and Canada Safety Requirements and Notices Donot touchormo veantenna whiletheu nitistra nsmitting or receiving. Donotholdanycomponentcontainingtheradiosuchthat theantennaisverycloseortouchinganyexposedparts ofthebody ,especiallytheface ...
-
Samsung Q46 - page 26
25 Caution Thisequipmenthasbeentestedandfoundto complywiththelimitsforaClassBdigitaldevice pursuanttoPart15oftheFCCRules.Theselimits aredesignedtoprovidereasonableprotection againstharmfulinterferenceinaresidential installation.? ...
-
Samsung Q46 - page 27
26 Caution Wirelessdevicesarenotuserserviceable.Donot modifytheminanyway . Modicationtoawirelessdevicewillvoidthe authorizationtouseit.Contactmanufacturerfor service. Caution FCC Statement for Wireless LAN use: “Whileinstallingandoperatingthistra ...
-
Samsung Q46 - page 28
27 Thisequipmentcannotbeusedonpubliccoinphone serviceprovidedbythetelephonecompany .Connection topartylineserviceissubjecttostatetariffs. TheT elephoneConsumerProtection Actof1991makes itunlawfulforanypersontouseacomputeroro ...
-
Samsung Q46 - page 29
28 Thistransmittermustnotbecollocatedoroperatein conjunctionwithanyotherantennaortransmitterexcept theinstalledBluetoothtransmitter . Operationofthisdeviceissubjecttothefollowingtwo conditions:(1)Thisdevicemaynotcauseharmful interferenc ...
-
Samsung Q46 - page 30
29 European Union CE Marking and Compliance Notices ProductsintendedforsalewithintheEuropeanUnionare markedwiththeConformitéEuropéene(CE)Marking, whichindicatescompliancewiththeapplicableDirectives andEuropeanstandardsandamendmentsidentied below .Thise ...
-
Samsung Q46 - page 31
30 T ranslated Statements of Compliance [English] ThisproductfollowstheprovisionsoftheEuropeanDirec- tive1999/5/EC. [Danish] Detteprodukterioverensstemmelsemeddeteuropæiske direktiv1999/5/EC [Dutch] DitproductisinnavolgingvandebepalingenvanEurop- eesDirectief199 ...
-
Samsung Q46 - page 32
31 General Europeanstandardsdictatemaximumradiatedtrans - mitpowerof100mWeffectiveisotropicradiatedpower (EIRP)andthefrequencyrange2400–2483.5MHz. Belgium Theproductmaybeusedoutdoors,butforoutdoortrans - missionsoveradistanceof300morm ...
-
Samsung Q46 - page 33
32 WEEE SYMBOL INFORMA TION Correct Disposal of This Product (W aste Electrical & Electronic Equipment) (Applicable in the European Union and other European countries with separate collection systems) Thismarkingshownonthep roductoritsliterature,indicatesthatit shouldnotbedisposedwithotherho ...
-
Samsung Q46 - page 34
33 Overview Before Y ou Start! ■ * Theitemsmarkedwiththissymbolareoptionalitemswhichmaybechangedormaynotbeprovideddependingonthe computermodel. ■ Theactualcolorandappearanceofthecomputermaydifferfromthepicturesusedinthisguide. ...
-
Samsung Q46 - page 35
34 4 Charge Status This shows the power source and the batterychargestatus. Green: Whenthebatteryisfully chargedorthebatteryisnotinstalled. Amber: Whenthebatteryisbeing charged. Off: Whenthecomputerisrunningon batterypowerwithoutbeingconnected to AC? ...
-
Samsung Q46 - page 36
35 Right V iew 1 Fan V ents Theinternalheatofthecomputerisemittedthroughtheseholes. Caution If the vents are blocked the computer may overheat. Avoidblockingtheventsasthismaybedangerous. 4 Modem Port * A port to which a telephone cable is conne ...
-
Samsung Q46 - page 37
36 Left V iew 1 Wired LAN Port * ConnecttheEthernetcabletothisport. p. 89 3 PC Card Slot * InstallthePCcardintothisslot. 2 CD Drive(ODD) * PlaysCDorDVDtitles. Since an ODD drive is optional, the installed drive dependsonthecomputermodel. p. 47 4 IEEE 139 ...
-
Samsung Q46 - page 38
37 4 Security Lock Port Y oucanconnectaKensingtonlocktothe SecurityLockPorttopreventthecomputerfrom beingstolen. Back V iew 2 Battery ThisisaLithium-Ionrechargeablebatterythat suppliespowertothecomputer . p.137 1 DC Jack A jacktoconnectthe AC ...
-
Samsung Q46 - page 39
38 Bottom V iew 1 Battery Latches Thelatchusedtoremoveorinstallthebattery . p.137 3 Memory Compartment Cover Themainmemoryisinstalledinsidethecover . p.135 2 Hard Disk Drive Compartment Cover Theharddiskdriveisinstalledinsidethecover . Caution Y ouwillbe ...
-
Samsung Q46 - page 40
39 T urning the Computer On and Off T urning the computer on 1 Installthe battery and connect the AC adapter . (Refertothe Installation Guide .). 2 LifttheLCDpanelup. 3 Pressthe Power button to turn the computer on. Note ■ IfyoupressandreleasethePowerbuttonon the computer when ...
-
Samsung Q46 - page 41
Chapter 2. Using the computer Keyboard 41 T ouchpad 44 CD Drive 47 InsertingandEjectingaCD 4 7 BurningaCD 4 8 HDDVD 4 9 Blu-ray 51 Multi Card Slot 53 PC Card Slot 56 Connecting a Monitor 57 ConnectingaMonitor 5 7 Viewing ThroughaMonitor 5 7 Adjusting the V olume 58 Using Digital Output (S/PDIF) ...
-
Samsung Q46 - page 42
41 Keyboard Thekeyboardissuppliedaccordingtothecorrespondingcountry .Refertothekeyboardgureforthecorrespondingcountry . United Kingdom United States ...
-
Samsung Q46 - page 43
42 Shortcut Keys Y oucanusethefollowingfunctionsbypressingthekeysbelowwiththe Fn key . Fn+ Name Function REST (Sleep Mode) SwitchestoSleepmode. T owakethecomputerup,pressthePowerbutton. Gauge Showstheremainingbatterycharge. Y oucanonlyusethisfun ...
-
Samsung Q46 - page 44
43 Screen Brightness Control T oadjusttheLCDbrightnesspressthe Fn +( )key combinationorthe Fn +( )keycombination.The changedscreenbrightnessisdisplayedatthecenterof the screen for a moment. V olume Control T ocontrolthevolume,pressthe Fn + ...
-
Samsung Q46 - page 45
44 T ouchpad Thetouchpadprovidesthesamefunctionasamouseandtheleftandrightbuttonsofthetouchpadplaystheroleof theleftandrightbuttonsofamouse. Before Y ou Start! ■ UsetheT ouchpadwithyourngers.Usingasharpobjectmaydamagethe ...
-
Samsung Q46 - page 46
45 Moving the cursor on the screen Placeyourngeronthetouchpadslightlyandmoveyour nger .Themousecursorwillmoveaccordingly .Move yourngerinthedirectionyouwishtomovethecursor . Click Function Placeyourngeronthetouchpadandtapyour? ...
-
Samsung Q46 - page 47
46 Drag Function Draggingreferstomovinganitemtoanotherplaceafter selectingit. Pressandholddownthelefttouchpadbuttonoveran itemyouwanttodragandmovetheitemtothenew location. T ouchpad Scroll Function Thetouchpadscrollareaprovidesthemou ...
-
Samsung Q46 - page 48
47 CD Drive Anopticaldiskdriveisoptionalandmaydifferdependingonyourcomputermodel.Fordetailedspecications,refer tothecatalog. Before Y ou Start! Oneofthefollowingopticaldiskdrivesisinstalledonthiscomputer . DriveT ype Function RW -Combo Y oucan? ...
-
Samsung Q46 - page 49
48 IfyourcomputerhasawritableCDdrive,youcanwrite dataontoaCDorDVDorburnanaudioCD. CyberLink DVD Suite issuppliedwiththe System Software Media (oranadditionalCD)sothatyoucan burnaCDusingtheprogram. Installtheprovidedsoftwa ...
-
Samsung Q46 - page 50
49 HD-DVDisanextgenerationstoragemediathatcansavemoredatathentheexistingDVDformat. Y oucanrecordandplaybetterqualityHDmoviesthantheexistingSD-gradeDVDformat. T ype HD DVD DVD CD Logo Storage Capacity 15GB/30GB 4.7GB/8.5GB 0.65 GB Dat ...
-
Samsung Q46 - page 51
50 About HD DVD TheCyberLinkHDDVDSolutionprogramisprovidedso thatuserscanconvenientlyandeasilyrecordmultimedia lesandotherdataontoHDDVDdisks. Foramoredetaileddescriptionofthefunctions,referto thehelpsectionofthecorrespondingpro ...
-
Samsung Q46 - page 52
51 Blu-rayisanextgenerationstoragemediathatcansaveapproximately5to10timesmoredatathentheexistingDVD format.Y oucanrecordandplaybetterqualityHDmoviesthantheexistingSD-gradeDVDformat. T ype Blu-ray DVD CD Logo Storage Capacity 25GB/50? ...
-
Samsung Q46 - page 53
52 About Blu-ray TheCyberLinkBDSolution(hereafterCBDS)programis providedsothatuserscanconvenientlyandeasilyrecord multimedialesandotherdataontoBlu-raydisks. Foramoredetaileddescriptionofthefunctions,referto thehelpsectionofthecorr ...
-
Samsung Q46 - page 54
53 Multi Card Slot Usingthemulticardslot,youcanreadandwritedatatoaMemoryStick,MemoryStickPro,SDcard,MMC,MMC Plus,andxDcard. Y oucanuseacardasaremovablediskandconvenientlyexchangedatawithdigitaldevicessuchasadigital ...
-
Samsung Q46 - page 55
54 T o Insert and Use a Memory Card 1 Insertacardintotheslotaccordingtothedirections printedontheslot. 2 Thecarddriveappears.Click Open folder and view les .Ifthewindowdoesnotappear ,click Start > Computer . Note If a window asking to scan and change appears ...
-
Samsung Q46 - page 56
55 T o remove a memory card 1 Pushthetipofthecardlightly . 2 Ifthecardpopsupwithaclickingsound,removethe card. T o format a memory card Y ouhavetoformatacardrsttouseit. Caution Formattingacarddeletesalldatasavedonthe card.Ifthe? ...
-
Samsung Q46 - page 57
56 T o insert a PC card 1 Insert a PC card into the PC card slot on the side of the computer . 2 Ifyou insert acard intothe slot,Windows recognizes the card automatically or a message telling you to install a driver appears. If th ...
-
Samsung Q46 - page 58
57 Connecting a Monitor Usinganexternaldisplaydeviceisusefulwhenyouaregivingapresentationorwatchingavideoormoviethrough yourmonitor . Before Y ou Start! Y ouhavetobuyaconnectioncableadditionally . ConnectthemonitortotheMonitorport. Connecting a Mon ...
-
Samsung Q46 - page 59
58 Adjusting the V olume using the Keyboard Pressthe Fn +( )keycombinationor Fn +( )key combinationtoadjustthevolume. Pressthe Fn +( )keycombinationtoturnthevolume on or off. Adjusting the V olume using the V olume Adjustment Program Clickthe V olume icon( ...
-
Samsung Q46 - page 60
59 Using SRS TheSRSfunctionenablesyoutoexperiencemore stereophonic sound using stereo speakers. 1 Right-clickoverthe V olume icon( )intheT askbar andselect Play Device (P) . 2 Select Speaker in the Play tabandclick Properties . 3 Selectthe SRS tab in the Speaker ...
-
Samsung Q46 - page 61
60 Using Digital Output (S/PDIF) Y oucanenjoy5.1channelsurroundsoundbyusingtheHeadphone/S/PDIFjack. Before Y ou Start! T o listen to 5.1 channel surround sound, follow the procedures below. ■ Connecttoa5.1channelspeakersystemusingtheHeadphone/S/PDIFjack. ■ SelectDigital? ...
-
Samsung Q46 - page 62
61 Connecting 5.1 Channel Speakers 1 ConnecttheS/PDIFcabletotheS/PDIFjackandconnecttheotherendofthecabletothe5.1channelspeaker system. Note Sincetheprocedurestoconnecta5.1channelspeakersystemmaydifferdependingonthesystemmodel,refer? ...
-
Samsung Q46 - page 63
62 Selecting Digital Output in the DVD Player Program. SincethesoundsettingissettoDigitalOutputbydefault,youdonotadditionallyneedtocongureitfordigitaloutput. Y oucanconrmyoursettingsasfollows. 1 IftheCyberLinkPowerDVDprogramisnotinstal ...
-
Samsung Q46 - page 64
Chapter 3. The screen shots used in this chapter may differ from actual screens depending on the Windows V ista version and model. Using Microsoft W indows V ista About Microsoft Windows V ista 64 WelcomeCenter 6 4 HelpandSupport 6 5 Windows V ista Screen Layout 66 Desktop 6 6 StartMenu 6 8 Sidebar/Gadget 7 0 Window ...
-
Samsung Q46 - page 65
64 IntheWelcomeCenter ,youcanviewbriefdescriptionsofWindowsVistafunctionsandrunthefunctionsdirectly . 1 Click Start > Welcome Center . 2 Ifyouclickonanitem,informationonthefunctionisdisplayedinthedescriptionwindow . Forexample,ifyou? ...
-
Samsung Q46 - page 66
65 Help and Support WindowsHelpandSupportprovidesinformationonWindowsbasicfunctionsandusages. Click Start > Help and Support . Y oucanndhelpforfrequentlyusedbasicfunctionsusingFindan Answerandyoucansearchforhelpbyenteringa keywordinthe? ...
-
Samsung Q46 - page 67
66 Windows V ista Screen Layout Desktop Ifyouturnthecomputeron,theDesktopscreenappears. Thedesktopistheworkingareaonthecomputer .Itconsistsofalargeworkspaceandataskbaratthebottomasshown inthegurebelow . Note Thescreenlayoutmaydiff ...
-
Samsung Q46 - page 68
67 1 Recycle Bin Y oucandropuselesslesandfoldershere. 2 Shortcut Icons Y oucanlaunchprogramsbyclickingtheshortcuticonsontheDesktop. 3 Start Menu Themenufromwhichyoucanlaunchprograms. 4 Start Button Pressthestartbutton.TheStartmenuappears. 5 T askbar C ...
-
Samsung Q46 - page 69
68 Start Menu Themenufromwhichyoucanlaunchprograms. Click Start ( ).TheStartmenuappears. Alternatively ,presstheWindowskey( )onthekeyboard. Fixed Programs The program or search result is displayed. All Programs Y ou can search for les, folders, etc. Username Search Computer Control Pane ...
-
Samsung Q46 - page 70
69 Search Enablesuserstosearchforlesandfolders. Computer Showsstoragedevicessuchasharddiskdrives,CD/DVDdrives,networkdrives,etc. Inaddition,youcanmanagelesandfoldershere. Control Panel EnablesuserstoconguretheappearanceandsettingsofW ...
-
Samsung Q46 - page 71
70 Sidebar / Gadget SidebarisaverticalbarthatappearsatthesideoftheDesktop. A miniprogramcalledGadgetrunsovertheSidebarwhichshowsinformationsuchasstocks,schedule,weather ,etc.and providesfrequentlyusedtools. Y oucandownloadvariousGadgets ...
-
Samsung Q46 - page 72
71 Adding a Gadget Y oucanndagadgetinthe Gadget Gallery andaddittotheSidebar . 1 Ifyouclickthe + atthetopoftheSidebar ,theGadgetGalleryopens. 2 Ifyoudouble-clickonagadget,thegadgetisaddedtotheSidebar . Note ■ Y oucan? ...
-
Samsung Q46 - page 73
72 Exiting the Sidebar Right-clickontheSidebaricon( )intheSystemT raywiththeclockonthetaskbarandselect Exit toexittheSidebar . Note Closing the Sidebar ■ EvenifyouclosetheSidebar ,theSidebarcontinuesrunningintheSystemT rayintheclock? ...
-
Samsung Q46 - page 74
73 Window A windowisthebasicframeforacomputeroperation. Asanexample,let’sseethelayoutofa Pictures Window . Click Start > Pictures. Note TheitemsandnamesmaydifferdependingonyourcomputermodelandtheWindowsV istaversion. Window Layout 1 Address ...
-
Samsung Q46 - page 75
74 1 Address Display Line Showsthelocationofthecurrentlyselectedfolderorle. 2 Move Button Y oucanmovetothepreviousornextpagebyclickingtheBackorNextbuttons. Opensthepreviouslyopenedpage. Opensthenextpage,whenyouhavereturnedtoapr ...
-
Samsung Q46 - page 76
Window V iew Functions Note Ifyouhavesetupthe Aerofunction,youcanuse the window view functions. Ifyouwanttousethe Aerofunction,click Start > Control Panel > Appearance and Personalization > Window Color and Appearance .SelectWindow Aerofromthecolor schemesa ...
-
Samsung Q46 - page 77
Control Panel T oolsforconguringWindowsarelocatedintheControlPanel. Opening the Control Panel Click Start > Control Panel . System and Maintenance Usingthisfunction,youcancongureWindowsperformanceoptions. Security Usingthisfunction,youcancheckthecurrentsecurity? ...
-
Samsung Q46 - page 78
User Accounts and Family Safety Y oucanchangetheuseraccountsettings,passwordsandconguretheParental Controlsfunction. Appearance and Personalize Usingthisfunction,youcanconguretheDesktopstyle,themeorscreensaver settings. Clock, Language, and Region Usingthisfun ...
-
Samsung Q46 - page 79
User Accounts UsingWindowsVistaUser Accounts,morethanoneusercaneasilysharethesamePC. Theprocedurestoaddanddeleteauseraccountandtoswitchusersaredescribedbelow . Adding User Accounts 1 Click Start > Control Panel> User Accounts and Family Safety . 2 Click? ...
-
Samsung Q46 - page 80
Removing User Accounts Note ■ Ifthereisonlyone administrator account for the computer ,youcannotdeletethe administrator account . ■ Y oucanonlydeleteanotheraccountwhenyou areloggedinasanadministrator . 1 Click Start > Control Panel > User Accounts and Family Saf ...
-
Samsung Q46 - page 81
Changing the screen resolution and the color Theresolutionreferstothenumberofpixelsdisplayedonthescreen.Whenincreasingtheresolution,theitemsonthe Desktopbecomesmallerandmoreitemscanbedisplayedonthescreen.Thehigherthecolorquality ,themor ...
-
Samsung Q46 - page 82
Conguring the Start Menu Power Button ThePowerbuttonontheStartmenu( )performs various operations depending on the settings. 1 Click Start > Control Panel > Hardware and Sound > Power Options and then Change Battery Settings . 2 Clickon Change Plan Settings inthecurrently selected? ...
-
Samsung Q46 - page 83
4 Selectapowerplanandclickthe OK button. T ype Description Power Button Image after Setting Change Sleep SetsthecomputertoenterSleepmode. Thescreenandharddiskwillbeturnedofftoreducethepowerconsumptionof theoverallsystem. IfyoupressthePower? ...
-
Samsung Q46 - page 84
Phishing Filter Settings 1 LaunchInternetExplorer . 2 Select T ools fromthemenuandclick Phishing Filter > Phishing Filter Settings . Phishing Filter Phishingisamethodusedbyhackerstoillegallycollectpersonalinformationsuchascreditcardnumbers,passwords, otheracc ...
-
Samsung Q46 - page 85
84 3 TheInternetOptionswindowopens. LocatethePhishingFilteritemintheSettingseld.Select T urn on automatic website checking andclickthe OK buttontousethePhishingFilter . 4 T onotusethePhishingFilter ,select T urn off automatic website checking in? ...
-
Samsung Q46 - page 86
User control function Usingthisfunction,youcancontrolthecontentyourchildrencanaccess.Y oucandetermineforhowlongtheycanuse thecomputerandthecontenttheycanaccess.Whenyouhavenishedthesettings,clickOKtonish. Conguring Parental Cont ...
-
Samsung Q46 - page 87
Using Activity Report Y oucanviewandevaluateyourchildren’sinternetaccess throughthe ActivityReport. 1 Openthe User Controls window referring to the descriptions of Parental Controls . 2 Set Activity Reporting to On . 3 T oviewthe ActivityReport,clickon View Activity Report on ...
-
Samsung Q46 - page 88
UsingWindowsMobileCenter ,youcaneasilycongurecomputersettingssuchasthevolume,thewirelessnetwork connectionsettings,thedisplaysettings,etc.allatthesametime. Note SomefunctionsmaynotbesupporteddependingontheWindowsVistaversion. 1 C ...
-
Samsung Q46 - page 89
Chapter 4. Using the Network Wired Network 89 Wireless Network 92 ConnectingtoaWirelessLAN 9 3 Using the Easy Network Manager 94 NetworkSettings 9 4 Usingin AnotherLocation 9 6 DiagnosingtheNetworkStatus 9 7 Connecting with a Modem 98 Bluetooth 99 BluetoothFunction 9 9 UsingBluetooth 10 0 ...
-
Samsung Q46 - page 90
89 1 ConnectaLANcabletothecomputer ’sLANport. 2 Click Start > Control Panel > Network and Internet > Network and Sharing Center . 3 Click Manage Network Connections fromtheleft pane. 4 Right-clickoverthe Local Area Connection and select Properties . Wired Network A ...
-
Samsung Q46 - page 91
90 5 Select Internet Protocol V ersion 4 (TCP/IPv4) from the Networking tabandclick Properties . Note ■ TheLANdevicedrivermaydifferdependingon yourLANdevicemodel. ■ T oaddanetworkcomponent,click Install in the screenshowninthegureabove.Y oucan ...
-
Samsung Q46 - page 92
91 Using both DHCP and a xed IP simultaneously Using the Alternate Conguration providingbyWindows Vista,youcansetbothautomaticandxedIP addresses andthenyoucanselecttouseeitherofthemtoconnect to the Internet. 1 Click Start > Control Panel > Network an ...
-
Samsung Q46 - page 93
92 Wireless Network A wireless network (Wireless LAN) environment is a network environment that enables communicating between multiplecomputersathomeorasmall-sizeofcethroughwirelessLANdevices. Before Y ou Start! ■ Thedescriptions beloware for computer ...
-
Samsung Q46 - page 94
93 Connecting to a Wireless LAN Ifthereisan AP ,youcanconnecttotheInternetviathe APusingtheWirelessLANconnectionmethodprovided byWindowsVista. 1 Right-clickoverthe Network Connections ( )icon onthetaskbarandclick Connect to the Network . 2 ...
-
Samsung Q46 - page 95
94 Using the Easy Network Manager EasyNetworkManagerisaprogramthathelpscongurethenetworksettings. EasyNetworkManagerprovidesthefollowingfeatures. Y ou can easily congure the network and printer settings. p. 94~95 Y ou can immediately use the network without having to dene new netwo ...
-
Samsung Q46 - page 96
95 5 Select Internet Direct Connection andclickthe Next button. 6 SelecttheLANdevice,setuptheIPaddressand clickthe Next button. 7 Click Add Printer and set up a printer according to thewizard.Whentheprinterhasbeenadded,click the Refresh button,sele ...
-
Samsung Q46 - page 97
96 Using in Another Location Byconguringthenetworksettings(IPaddress,printer setting,etc.)foreachlocation,youcanimmediately accessthenetworkinoneclick,withoutperformingthe networksettingproceduresregardlessofyourlocation. 1 Click Start > All Pr ...
-
Samsung Q46 - page 98
97 Diagnosing the Network Status Y oucandiagnosethenetworkstateandndsolutionsfor whyyoucannotconnecttothenetwork. 1 LaunchEasyNetworkManager . 2 Select Management > Diagnose Status from the menu. 3 TheNetworkConnectionswindowappears. Click Start to start ...
-
Samsung Q46 - page 99
98 1 ConnectthephonecabletotheModemport. T akecaretonotconnectadigitalphonelinetothemodemport. 2 ConnecttotheInternetaccordingtotheinstructionsofyourInternetserviceprovider(ISP). Note IftheInternetconnectionisterminatedabnorm ...
-
Samsung Q46 - page 100
99 File T ransmission Y oucanexchangelesbetweentwoBluetoothdevices. Y oucanexchangeleswithanotherBluetoothdevicesuchasanothercomputer ,cell phone,PDA,etc. Network Access Y oucanconnecttoanotherBluetooth-installedcomputerinthesamewayasan Ad ...
-
Samsung Q46 - page 101
100 Using Bluetooth Theprocedurestoexchangelesbetweencomputers supportingBluetoothandtouseotherBluetoothdevices aredescribedbelow . Using Bluetooth Devices (Connecting Headset supporting Bluetooth) Asanexample,theprocedurestoconnecttoaheadset supportingBluetooth? ...
-
Samsung Q46 - page 102
101 5 EnterthePINinthedevicePINeldandclickthe Next button. Note Forpairing,aPINisrequired.SinceaPINis providedbytheheadsetmanufacturer ,refertothe correspondingmanual. 6 IftheCompletingthe AddBluetoothDeviceWizard window? ...
-
Samsung Q46 - page 103
102 3 SelectaBluetoothdevicetosendthelefromand clickthe OK button. 4 EnteraPINintheBluetoothPINCodeeldandclick the Next button. Note The Bluetooth PIN Code is a password used for connectingtwoBluetoothdevices.Theuserjust entersthesame ...
-
Samsung Q46 - page 104
Chapter 5. Using Applications Introducing Programs 104 CyberLink PowerDVD 107 Samsung Update Plus 109 Play A VStation 1 1 1 LaunchingandScreenLayouts 1 1 1 MovieStation 1 1 2 MusicStation 1 1 6 PhotoStation 12 0 A VStation Now 124 Start 12 4 Exit 12 4 ScreenLayout 12 4 Play Camera 125 ...
-
Samsung Q46 - page 105
104 Introducing Programs UsingthesoftwaresuppliedwiththeSamsungcomputer ,youcaneasilyusefunctionsandtroubleshootproblems. T rytousethesoftwareafterlearningaboutthebasicuseofthesoftware.Fordetailedinformation,refertothehelp section of the corr ...
-
Samsung Q46 - page 106
105 Multi Media Functions CyberLink PowerDVD ( ) (Optional) T ousethisprogram,youhavetoinstalltheprogram manuallyusingtheadditionallysuppliedSystem SoftwareMedia(orotherCD). p.107 Play A VStation ( ) (Optional) Play A VStationisanintegratedmultimediaprogr ...
-
Samsung Q46 - page 107
106 T roubleshooting Functions SAMSUNG Magic Doctor ( ) SAMSUNGMagicDoctoristroubleshootingsoftware providedbySamsungComputerforsystemdiagnosis, andrestoringthesystem. Thesystemdiagnosisfunctionenablesusersto diagnosesystemproblemswithoutassistancefrom others ...
-
Samsung Q46 - page 108
107 1 InsertaDVDtitleintotheDVDdrive. 2 Select PowerDVD andclickthe OK button. Afteramoment,theDVDtitlewillplay . 3 IftheDVDtitleisnotautomaticallyplayed,click Start > All Programs > CyberLink DVD Suite > Power DVD > CyberLink PowerDVD . 4 ...
-
Samsung Q46 - page 109
108 Note ■ Detailed Usage Formoredetailedusage,click Start > All Programs > Cyberlink DVD Suite > Power DVD > PowerDVD Help . ■ DVD Region Code A DVDtitlehasaregioncodeaccordingtotheinternationalspecicationssothatitcanbeplayedonlyinthatspecic? ...
-
Samsung Q46 - page 110
109 Samsung Update Plus SamsungUpdatePlusissoftwarethatexaminesandupdatestheSamsungsoftwareanddriversinstalledonyour Samsungcomputertothelatestversion. Before Y ou Start! ■ T osearchforupdatesandupdateyourcomputerusingSamsungUpdatePlus,your ...
-
Samsung Q46 - page 111
1 10 3 Ifthereareavailablesoftwareordriverupdatesfor yourcomputer ,theavailableupdateswillbelisted. Selecttherequiredupdatesfromthelistandclickon Install Updates to start the update. Caution Updates that must be installed separately . Ifyouselect Install f ...
-
Samsung Q46 - page 112
1 1 1 T olaunchtheprogram,click Start > All Programs > Samsung > Play A VStation > Play A VStation . Alternatively ,double-clickthePlay A VStationicon( )ontheDesktop. Movie Y oucanplayavideo(movie)leoraDVD/VCDtitle. Music Y oucanplayamusicleoran ...
-
Samsung Q46 - page 113
1 12 Note ● What is EDI (Enhanced Digital Image)? EDI(EnhancedDigitalImage)isvisualqualityenhancementtechnologydevelopedbySamsungElectronics.Y oucanview clearerandsharperimagesbyenablingtheEDIfunctionwhenwatchingTVorplayingamovieonPlay A VStation ...
-
Samsung Q46 - page 114
1 13 Playing a Movie File TheprocedurestoplayamovieleregisteredtotheMOVIELibraryaredescribedbelow .Fortheprocedurestoregister lestotheLibrary ,referto p.1 14. 1 Moveto Movie Station anddouble-click All Video intheleftmenupane. ...
-
Samsung Q46 - page 115
1 14 Adding Videos to the Library TheMovieLibraryisalibrarywithmovielestobeused byMovieStation.Theprocedurestoaddmovieles savedonthecomputertotheLibraryaredescribedbelow . Y oucanaddlesorfolders. Asanexample,the procedure ...
-
Samsung Q46 - page 116
1 15 Highlight / Chapter Function UsingtheHighlightfunction,youcanwatchahighlighted part of a movie such as a sports or news item, etc. Using theChapterfunction,youcancreatechaptersforamovie andplaythemoviefromanyofthechapters. Note The Highlight/Chapter function ...
-
Samsung Q46 - page 117
1 16 Music Station LaunchPlay A VStationandclick Music on the Station Bar . Playlist Window Music Search V olume Control Music Library Music T ype Repeat Setting Random Play Setting EQ EDS Play Control Buttons ...
-
Samsung Q46 - page 118
1 17 Playing an Audio CD TheprocedurestoplayanaudioCDaredescribedbelow . 1 InsertanaudioCDintotheCDdrive. 2 Ifthe AutoPlaywindowappears,select Play audio CD using Samsung PLA Y A VStation . 3 TheCDisplayed. Note IfaCDisalreadyinsertedinthe ...
-
Samsung Q46 - page 119
1 18 Playing a Music File IfamusicleisregisteredtotheMusicLibrary ,youcaneasilyplaythemusicle.Fortheprocedurestoregistertracksto theLibrary ,referto p.1 19. 1 Moveto Music Station anddouble-clickon All Music . 2 Double-clicka ...
-
Samsung Q46 - page 120
1 19 Adding Music Files to the Library TheMusicLibraryisalibrarywithmusiclesusedby MusicStation.Theprocedurestoaddmusiclessaved onthecomputertotheLibraryaredescribedbelow . Y oucanaddles,folders. Asanexample,theprocedurestoa ...
-
Samsung Q46 - page 121
120 LaunchPlay A VStationandclickon Photo on the Station Bar . Photo Station Photo Library Photo List and Thumbnail Window Batch Edit Button SlideShow Button View and Edit Button ...
-
Samsung Q46 - page 122
121 Viewing an Image TheprocedurestoviewimagesregisteredtothePhoto LibraryindividuallyandviaaSlideShowaredescribed below . FortheprocedurestoregisterimagelestotheLibrary , refer to p.123. 1 Moveto Photo Station anddouble-clickon All Image ...
-
Samsung Q46 - page 123
122 Editing an Image Y ou can change the shape of an image, edit an image orapplyspecialeffectstoanimage. Theimageediting functionsaredescribedbelow . 1 Moveto Photo Station anddouble-clickon All Images . 2 Clickonafolderwhichincludesimages,andthe imagesi ...
-
Samsung Q46 - page 124
123 Adding Images to the Library ThePhotoLibraryisalibrarywithimagelestobeusedbyPhotoStation.Theprocedurestoaddimagelessavedon thecomputertotheLibraryaredescribedbelow . Y oucanaddles,addfolders. Asanexample,theprocedures ...
-
Samsung Q46 - page 125
124 A VStation Now Using A VStationNow ,youcaneasilyandquicklyplaymusic,photographs,moviesandDVDswhenthecomputeris on/off. Start Pressthe A VNow( )buttonwhenthecomputerisonor offtolaunch A VStationNow . Music: Play A VStationislaunched? ...
-
Samsung Q46 - page 126
125 Play Camera PlayCameraisaprogramthatenablesuserstotakestillpicturesorrecordvideosusingthecamerainstalledonthe computer . Before Y ou Start! ■ Theprogramversionsdescribedinthismanualaresubjecttochangeandthescreenimagesandtermsin ...
-
Samsung Q46 - page 127
Chapter 6. Settings and Upgrade LCD Brightness Control 127 BIOS Setup 128 EnteringtheBIOSSetup 12 8 TheBIOSSetupScreen 13 0 Setting a Boot Password 132 Changing the Boot Priority 134 Upgrading Memory 135 Battery 137 Installing/RemovingtheBattery 13 7 ChargingtheBattery 13 8 MeasuringtheRemainingBat ...
-
Samsung Q46 - page 128
127 Controlling the Brightness Using the Keyboard AdjusttheLCDbrightnessbypressingthe Fn +( )keyorthe Fn +( )key . TheLCDbrightnesscanchangeupto8levelsandthebrightnessincreasesby1levelwhenpressingthe Fn +( )key once. Note ■ M ...
-
Samsung Q46 - page 129
128 1 T urn the computer on. 2 Whenthebootingscreen(SAMSUNGlogo)appears,presstheF2keytoentertheBIOSSetup. Entering the BIOS Setup BIOS Setup TheBIOSSetupenablesyoutocongureyourcomputerhardwareaccordingtoyourneeds. Before Y ou Start! ■ UsetheBIOS ...
-
Samsung Q46 - page 130
129 3 Afteramoment,theBIOSsetupscreenappears. TheitemsintheBIOSsetupmaydifferdependingontheproduct. Setup Menu Setup Items Help Helpfortheselecteditem appearsautomatically . ...
-
Samsung Q46 - page 131
130 The BIOS Setup Screen Menu Description Main Usedtochangethebasicsystemandenvironmentsettings. Advanced Usedtocongureadvancedfunctionsonyourcomputerarounddevicesandchipsets. Security Usedtoconguresecurityfunctions,includingpasswords. Boot Usedtosettheboo ...
-
Samsung Q46 - page 132
131 System Setup Keys IntheSetup,youhavetousethekeyboard. F1 PresstoviewtheSetupHelp. Up & Down Keys Presstomoveupanddown. F5/F6 Presstochangetheitemvalue. F9 PresstoloadthedefaultSetupsettings. ESC Presstoreturntoahigherlevelmenuor ...
-
Samsung Q46 - page 133
132 Setting a Supervisor Password A SupervisorPasswordisrequiredtoturnthecomputer onortostarttheSystemSetup. WhensettingaSupervisorPassword,usersotherthana supervisor cannot use the computer . 1 Selectthe Security menuintheBIOSSetup. 2 In the Set Superv ...
-
Samsung Q46 - page 134
133 Setting a User Password Userscanstartthesystemwithauserpassword,but cannotentertheSystemSetup.Bydoingthis,youcan prevent other users from entering Setup. Beforeconguringauserpassword,asupervisor passwordmusthavebeencongured.Deactivatingthe? ...
-
Samsung Q46 - page 135
Boot Device Priority Boot priority order: ▼ IDE CD : xxxxxxxxxxxxxxxxxxx ▼ IDE HDD : SAMSUNG xxxxxxx ▼ USB KEY : Not Installed ▼ USB CDROM : Not Installed ▼ USB FDC : Not Installed ▼ USB HDD : Not Installed ▼ PCI BEV : Not Installed ▼ ▼ USB ZIP : Not Installed ▼ USB LS120 : Not Installed Excluded from boot order: Select system b ...
-
Samsung Q46 - page 136
135 Upgrading Memory Oneormorememorymodulesareinstalledonthecomputer . Thereare2memoryslotsanduserscanreplacetheinstalledmemoryoraddnewmemory . Before Y ou Start! ■ Replaceorinstallnewmemoryonlyaftershuttingthecomputerdowncompletely .Do? ...
-
Samsung Q46 - page 137
136 3 Pushthememorymoduledownsothatitis completelyxed.Ifthememorydoesnotteasily , pushthememorymoduledownwhilepullingthe memorymodulelatchesoutward. 4 Closethememorycompartmentcoverandfasten the screw . Note Removing a memory mo ...
-
Samsung Q46 - page 138
137 1 Shutdownthesystem,closetheLCDpaneland placethecomputerupsidedownonaatsurface. 2 Pullthetwobatterylatchesoutwards( ),then removethebattery . 3 T oinstallthebatteryagain,slidethebatteryintothe system. Thebatterylat ...
-
Samsung Q46 - page 139
138 T o view on the battery Separatethebatteryandpressthe PUSH buttoninside thebattery .Theremainingbatterycharge(%)willbe displayed. Note Battery W arning ■ Y ouwillhearanalarmwhentheremaining batterychargereachesbelow10%. Inthiscase,connectt ...
-
Samsung Q46 - page 140
Extending the Battery Usage T ime 139 Decreasing the LCD Brightness Pressthe Fn +( )keysonthekeyboardtodecreasetheLCDbrightnesstoextendthebatteryusagetime. Using Easy Battery Manager EasyBatteryManagerisapowermanagementprogramthatenablesusingthebatterypo ...
-
Samsung Q46 - page 141
Samsung Optimized Thismodeisappropriatefornormalconditions.Itmaximizesthesystemperformancewhenthecomputerisrunningon ACpowerwhilemaximizingthebatteryusagetimewhenthecomputerisrunningonbatterypower . Multimedia Thismodeisappropriatefora? ...
-
Samsung Q46 - page 142
141 Using the Battery Calibration Function Whencharging/dischargingthebatteryrepeatedlyfora shorttimeonly ,thebatteryusagetimemaybereducedby thedifferencebetweentheactualbatterychargeandthe remainingchargedisplay . Inthiscase,theactualbatterycha ...
-
Samsung Q46 - page 143
142 Using the Security Lock Port Y oucanconnectaKensingtonlocktotheSecurityLockporttopreventyourcomputerbeingstolenwhenyouhaveto usethecomputerinapublicplace. T ousethisfeature,youhavetopurchasetheKensingtonlockadditionally .T ous ...
-
Samsung Q46 - page 144
Chapter 7. W indows Media Center About Package Contents and the Program Guide 144 Connecting and Setting Up Media Center 145 OptionalDevices 14 5 Using Media Center 149 StartScreenLayout 14 9 Pictures+Videos 15 0 Music 15 4 TV+Movies 15 8 Windows Media Center is provided for some versions of Windows V ista only . ...
-
Samsung Q46 - page 145
144 About the Package Contents ThepackagecontentsofyourSamsungcomputermaydifferdependingonthecomputermodel. TheMediaCenterremotecontrol,external-typeremotecontrolsensorandTVtunercardarenotsuppliedwithyour computerandthedevicesarenotrequire ...
-
Samsung Q46 - page 146
145 Connecting and Setting Up Media Center ThebasicusageofMediaCenterforMicrosoftWindowsVistaHomePremiumisdescribedbelow . Before Y ou Start! ■ ThismanualwilldescribeproceduresassumingthatyouareusingMediaCenterwithamouse. ■ SinceMediaCentersupp ...
-
Samsung Q46 - page 147
146 TV T uner Card UsingaTVtunercard,youcanwatchandrecord TV programs. Somemodelshavebuilt-inTVtunercards. Thismanual describestheirusageassumingyourcomputerhasa built-inTVtunercard. Caution TherearetwotypesofTVtunercards,built-in ...
-
Samsung Q46 - page 148
147 Media Center Setup ConnectallnecessarydevicesandsetupMediaCenter . Y ouhavetocompletethesettingstouseMediaCenter . 1 T urn the computer on. 2 Click Start > Windows Media Center or Start > All Programs > Windows Media Center . 3 Ifthefollowingstartscreenappears ...
-
Samsung Q46 - page 149
148 4 IfyouhaveselectedCustomSetup,continuewith thesetupaccordingtotheSetupWizardinstructions. IftherearenoinstalledTVtunercards,the TV relatedsetupstepswillappearduringtheMedia Centersetup. In addition, if the computer is not connected to the ...
-
Samsung Q46 - page 150
149 Start Screen Layout Before Y ou Start! Ifyouselected Run Setup Later intheMediaCenterstartscreenordidnotcompletetheSetupWizard,theSetupWizardscreen appearswhenlaunchingMediaCenter . Ifyoucompletethesetup,theMediaCenterstartscreenappears. ...
-
Samsung Q46 - page 151
150 Pictures + Videos: Y ou can view pictures, images and videoles. Music: Y oucanlistentomusicles,audioCDsandthe radio. TV + Movies : Y ou can watch and record TV programs andplayDVDtitles. Online Media: Y oucanaccessallkindsofmultimedia content over the . T asks: ...
-
Samsung Q46 - page 152
151 3 IftheLibrarySetupscreenappears,select Add Folder to W atch . 4 Specifythepathforthefolderaccordingtothe instructions on the screen. 5 Ifthefollowingscreenappears,click Finish . Y ou can viewthenewlyaddedfolderinthePictureLibraryor Video ...
-
Samsung Q46 - page 153
152 4 Ifyouselectapicture,thepictureisdisplayedinfull screen. Y oucanviewanotherpicturebyusingthePlay Controlbuttonsorthedirectionbuttonsonthe keyboard. 5 T oviewpicturesinaSlideShow ,clickon Play SlideShow . Alternatively ,select? ...
-
Samsung Q46 - page 154
153 Viewing Pictures and V ideos Saved on Removable Media The procedures to view pictures, images and videos savedonremovablemediainMediaCenteraredescribed below . 1 LaunchMediaCenter . 2 Insertaremovablemediawithpicture,imageor videoles. Removablemediareferstoa? ...
-
Samsung Q46 - page 155
154 InMusicofMediaCenter ,youcanplaymusiclesor audioCDs.Inaddition,youcanripthetracksofanaudio CDontothecomputerandplaythemlaterindividuallyor byusingaplaylist. Playing an Audio CD 1 LaunchMediaCenter . 2 PresstheEject? ...
-
Samsung Q46 - page 156
155 4 IftheRipCDwindowappears,click Y es . 5 RippingaCDbeginsbyshowingrotatingCDicon ontherightsidethatindicatesrippingaCDisin progress.Whenrippingiscomplete,therippingCD completemessageappears. Note Therippedtracksared ...
-
Samsung Q46 - page 157
156 Using Playlists Y oucaneasilycreate,manageandplayaplaylistwith rippedmusicalbumsandmusiclesdownloadedfromthe Internet. 1 LaunchMediaCenter ,andselect Music > Music Library . 2 Y oucansearchforamusiclebyselectingthe album,art ...
-
Samsung Q46 - page 158
157 6 Select Save As Playlist ,enteraplaylistnameand select Save .Ifyouhavearemotecontrol,youcan enteranameusingthenumericbuttonsonthe remotecontrol. 7 T oplaythesavedplaylist,select Media Center > Music Library > Playlist ,selecta ...
-
Samsung Q46 - page 159
158 Before Y ou Start! TheTVfunctionisonlyavailablewhena TVtunercardis installedonyourcomputer . TV + Movies Menus Live TV : Y oucanwatchliveTV programs. Recorded TV : Y ou can watch recorded TV programs. Guide (TV Broadcast Program Guide - EPG) Y ou can view the TV program guide. Y ou ...
-
Samsung Q46 - page 160
159 Playing a DVD TheprocedurestowatchaDVDtitlearedescribedbelow . 1 LaunchMediaCenter . 2 PresstheEjectbuttonoftheDVDdriveto open the trayandinsertaDVDtitle. Note IfyouinsertaDVDtitlewithoutstartingMedia Center ,the AutoPlay ...
-
Samsung Q46 - page 161
160 Online Media Y oucanaccessmoreonlinecontentthroughOnline Spotlight. OnlineSpotlightisaserviceprovidedbycontent providersviatheMediaCenter .Y oucanenjoyallkinds ofmultimediacontentsuchasmovies,news,sports,etc. over the Internet. Note ■ T ...
-
Samsung Q46 - page 162
Chapter 8. Appendix Using McAfee SecurityCenter 162 Using Samsung Magic Doctor 163 Reinstalling Software 165 Q & A 167 DisplayRelated 16 7 ModemRelated 16 8 WiredNetwork(LAN)Related 17 0 WirelessNetwork(WLAN)Related 171 GameandProgramRelated 17 5 Bluetooth 17 6 HDDVD 17 7 Blu-ray 17 8 ...
-
Samsung Q46 - page 163
162 Using McAfee SecurityCenter A computervirusisaprogramthatdamagescomputerlesandinformationsavedonacomputer . A computer isinfectedbyanalreadyinfectedleorbyanothercomputerovertheInternet.Let’slearnhowtouseMcAfee SecurityCenter ...
-
Samsung Q46 - page 164
163 Using Samsung Magic Doctor MagicDoctoristroubleshootingsoftwareprovidedbySamsungComputer . A usercandiagnosesystemproblemsvia one-clickorbyselectingdiagnosticitems. Before Y ou Start! Thescreensusedinthismanualmaydifferfromactualscreensaccordingto ...
-
Samsung Q46 - page 165
164 Viewing My Computer Information Y oucanviewdetailedinformationaboutyourcomputerinSamsungMagicDoctor . Clickontheiconintheshapeofamonitoratthebottomofthemainprogramscreentoviewdetailedinformationabout the computer . ...
-
Samsung Q46 - page 166
165 Reinstalling Software Y oucanreinstallsoftwareusingtheSystemSoftwareMedia,whenadevicedriverorcomputerapplicationisnot workingproperly . Before Y ou Start! Whensoftwareisnotworkingproperly ,itisrecommendedremovingthesoftwareusingthe AddorRemo ...
-
Samsung Q46 - page 167
166 StandardInstallation Ifyouselectthisoption,programsnotcurrentlyinstalledonthecomputerarelisted. MinimumInstallation Ifyouselectthisoption,programsarelistedthatneedtobeinstalledonthecomputer(drivers, Windowsupdates,etc.). Y ou can ...
-
Samsung Q46 - page 168
167 Q & A Thissectionprovidesinformationonpossibleproblems,solutionsandotherreferencesforusingthesystem. Q The LCD screen is too dark or too bright. A T urntheLCDbacklightonoradjusttheLCD brightness. Press Fn +( )toturntheLCDbacklightonor press Fn ...
-
Samsung Q46 - page 169
168 Q The shortcut icons are not displayed on the screen even if I press the shortcut key . A TheshortcuticonsonlyappearwhentheEasy DisplayManagerprogramisinstalled. Q I have connected a monitor (or projector) to the computer , but the colors on the monitor are abnormally displayed. A Checkifthemonitor? ...
-
Samsung Q46 - page 170
169 Q When you are unable to make a call when using a switchboard A Ingeneral,thedialtoneofaswitchboardoradigital phoneswitchingsystemisnotcontinuousunlikethat ofaPSTNline.Therefore,themodemmaynotmake aphonecallasitmisreadsthedialtone? ...
-
Samsung Q46 - page 171
170 Q How can I receive a F AX in Sleep mode (Standby Mode)? A T oreceiveaF AXwhenthecomputerisinSleep Mode(StandbyMode),thecomputermustbe conguredasfollows. TheF AXprogrammustbeconguredsothatit receivesF AXESautomaticallyreferringtotheF AX? ...
-
Samsung Q46 - page 172
171 Q I cannot nd an AP . A V erifywhethertheWirelessLANLEDison. Ifitisturnedoff,turnitonbypressingtheWireless LANOn/Offbutton( Fn + ). Q The Wireless LAN device is operating properly , but I cannot connect to the Internet or to another computer . ► This is due to an in ...
-
Samsung Q46 - page 173
172 Q The signal strength is excellent, but I cannot connect to the network. ► Even if the signal strength is excellent, the network connection may not operate properly if the TCP/IP properties are not properly congured, or the network key (encryption key) is incorrect. A CheckthattheTCP/IP propertiesarecongured pro ...
-
Samsung Q46 - page 174
173 A2 V erify whether the same network key (encryption k e y ) h a s b e e n e n t e r e d f o r b o t h t h e A P a n d t h e computer . The network key is an encryption key for encrypting the data transmitted between the AP and the comp ...
-
Samsung Q46 - page 175
174 Q I cannot connect to a computer connected to the Ad-Hoc network. A1 Check the security settings and network name of the wireless Ad-Hocnetwork. A2 Check the TCP/IP settings of the computers connected to the wireless Ad-Hoc network. The IP addresses of the ...
-
Samsung Q46 - page 176
175 Game and Program Related WindowsVistamaynotprovidesomefunctionsproperly whenperformingsomeapplicationsespeciallygames,or maycauseaproblemduetoadevicedrivercompatibility issue.Forthelatestdevicedriversandbugxes,please refertothere ...
-
Samsung Q46 - page 177
176 Q The Korean or Chinese characters in a business card received via Bluetooth are broken A1 IfyousendabusinesscardincludingKorean orChinesecharactersbyselectinga Select a business card in the le (*.vcf, *.vcd) option, the charactersonthereceivedcardwillbebroken. Thisisbecaus ...
-
Samsung Q46 - page 178
177 Right-click over the Bluetooth icon on the taskbar , select Audio tab > Connected Device , and check if Activate Mono Headset i s selected. If not, right-click over the device and select Connect . Right-clickove rthe Speaker icononthe taskbar , sel ...
-
Samsung Q46 - page 179
178 Q Can I watch full-HD grade video les? A Y es. Q Can I burn a HD DVD disk using a general CD-RW or DVD-RW drive? A A generalCD-R WorDVD-R Wdrivedoes notsupport burningtheHDDVDformat. Q Ca n I b urn a HD D VD dis k us in g th e Cy be rL ink DVD Solution? A Although the CyberLink DVD Solution? ...
-
Samsung Q46 - page 180
179 Other Q A 4GB memory capacity is not recognized by Windows. A Windows Vista cannot display more than 4GB o f m e m o r y d u e t o l i c e n s e p r o b l e m s a n d d r i v e r compatibilityreasons. Although the memory capacity is displayed as 3GB in the sy ...
-
Samsung Q46 - page 181
180 About Intel Media Sharing Software (Only for some models) IntelMediaSharingSoftwareenablesuserstoaccess,downloadandplayallkindsofmedialessuchasmusic, video,imageandpicturelesinthehomenetworkenvironment. IntelMediaSharingSoftwarerunsonInte ...
-
Samsung Q46 - page 182
181 Product Specications Thesystemspecicationsmaydifferdependingonthederivedmodels.Fordetailedsystemspecications,referto theproductcatalog. NT -Q45/Q46 CPU * Intel®Core2DuoProcessor ,IntelCeleronMProcessor Cache Memory * 2MB/4MB Main Memory * 512MB~2 ...
-
Samsung Q46 - page 183
182 Wireless LAN Specications (802.1 1a/b/g, 802.1 1n Card) Intel(R) PRO/Wireless 3945ABG Network Adapter Device The Name of the Registered Equipment : Special Low Power Wireless Device for Wireless Data Communication Systems. Item Detailed Specications Physical Specications Dimensions 30.0×5 ...
-
Samsung Q46 - page 184
183 Radio Specications RF Band 2.4GHz,5GHz Supported Channels Channelsallowedpercountry . Device T ransceiver Standard Output Power 5mW Modulation Scheme 1 1amode:OFDM 1 1bmode:DSSS 1 1gmode:OFDM Data Rate (Mbps)* 1 1amode**:54,48,36,24,18,12,9,6 1 1bmode:1 1,? ...
-
Samsung Q46 - page 185
184 Intel(R) PRO/Wireless 4965 AGN Network Connection Device The Name of the Registered Equipment : Special Low Power Wireless Device for Wireless Data Communication Systems. Item Detailed Specications Physical Specications Dimensions 30.0×50.95mm(WidthXHeight) Operating T emperature ...
-
Samsung Q46 - page 186
185 Radio Specications RF Band 2.4GHz,5GHz Supported Channels Channelsallowedpercountry . Device T ransceiver Modulation Scheme 1 1amode:OFDM 1 1bmode:DSSS 1 1gmode:OFDM 1 1nmode:MIMO Data Rate (Mbps)* 1 1amode**:54,48,36,24,18,12,9,6 1 1bmode: ...
-
Samsung Q46 - page 187
186 Registered T rademarks SamsungisaregisteredtrademarkofSamsungCo.,Ltd. SENSisaregisteredtrademarkofSamsungElectronics Co.,Ltd. Intel,Pentium/Celeronareregisteredtrademarksofthe IntelCorporation. Microsoft,MS-DOS,andWindowsareregistered trademarksof ...
-
Samsung Q46 - page 188
187 Glossary TheGlossaryliststheterminologiesusedinthisUserGuide. Forterminologiesotherthanthese,lookinWindowsHelp. Backup A waytosavethecurrentdatatorestoreitlaterif necessary . A backupisawaytorestorecomputerdata when the data o ...
-
Samsung Q46 - page 189
188 Firewall A securitysystemusedtoprotectaninternalnetworkor intranetfromexternalnetworks through an authentication procedure. Hibernation Mode A powermodethatsavesalldatainmemorytothe harddiskandturnstheCPUandharddiskoff.When cancelingHiber ...
-
Samsung Q46 - page 190
189 Quick Launch Thisreferstoatoolbarthatcanbeconguredsothat youcanlaunchaprogramsuchasInternetExploreror displaytheWindowsDesktopwithoneclick.Y oucan addanyicontothequicklaunchareaoftheT askbar andlaunchfrequentlyu ...
-
Samsung Q46 - page 191
190 USB (UniversalSerialBus) Thisreferstoaserialinterfacestandarddeveloped toreplacetheconventionalinterfacestandardssuch asSerialandPS/2.WhileUSB1.1supports12Mbps (12millionbitspersecond),USB2.0supportsadata ratethatis40times? ...
-
Samsung Q46 - page 192
191 Index A A VStationNow 124 B Battery 137 BatteryCalibration 141 BIOSSetup 128 Bluetooth 99 BootingPriority 134 C CDDrive/Recording 47 Charge 138 Click 45 Connecting AP/ AP 92 Connect/OutputMonitor 57 ControlPanel 76 CyberLinkPowerDVD ...
-
Samsung Q46 - page 193
192 Contact SAMSUNG WORLD WIDE [U.S.A. / U.K. / AUSTRALIA / HONG KONG / MALA YSIA / SINGAPORE] Contact SAMSUNG WORLD WIDE IfyouhaveanycommentsorquestionsregardingaSamsungproducts,contacttheSAMSUNGcustomercare center . Customer Care Center TEL Web Site U.S.A. 1800SAMSUNG(7267864) www .samsung. ...
-
Samsung Q46 - page 194
193 [IT AL Y] Contatta SAMSUNG SehaicommentiorichiestesuiprodottiSamsungcontattailnostroServizioClienti. Customer Care Center TEL Web Site IT AL Y 199153153 www .samsung.com/it/ [RUSSIA / UKRAINE] Customer Care Center TEL Web Site RUSSIA 8-800-200-0400 www .samsung.ru UKRAINE 8-800-502-0000 www .samsung. ...
A group of documents referred to as user manuals is also divided into more specific types, such as: Installation manuals Samsung Q46, service manual, brief instructions and user manuals Samsung Q46. Depending on your needs, you should look for the document you need. In our website you can view the most popular manual of the product Samsung Q46.
Similar manuals
A complete manual for the device Samsung Q46, how should it look like?
A manual, also referred to as a user manual, or simply "instructions" is a technical document designed to assist in the use Samsung Q46 by users. Manuals are usually written by a technical writer, but in a language understandable to all users of Samsung Q46.
A complete Samsung manual, should contain several basic components. Some of them are less important, such as: cover / title page or copyright page. However, the remaining part should provide us with information that is important from the point of view of the user.
1. Preface and tips on how to use the manual Samsung Q46 - At the beginning of each manual we should find clues about how to use the guidelines. It should include information about the location of the Contents of the Samsung Q46, FAQ or common problems, i.e. places that are most often searched by users in each manual
2. Contents - index of all tips concerning the Samsung Q46, that we can find in the current document
3. Tips how to use the basic functions of the device Samsung Q46 - which should help us in our first steps of using Samsung Q46
4. Troubleshooting - systematic sequence of activities that will help us diagnose and subsequently solve the most important problems with Samsung Q46
5. FAQ - Frequently Asked Questions
6. Contact detailsInformation about where to look for contact to the manufacturer/service of Samsung Q46 in a specific country, if it was not possible to solve the problem on our own.
Do you have a question concerning Samsung Q46?
Use the form below
If you did not solve your problem by using a manual Samsung Q46, ask a question using the form below. If a user had a similar problem with Samsung Q46 it is likely that he will want to share the way to solve it.